Sequence (fasta): 5ppaDownload

>5PPAA:Bromodomain-containing protein 1
MHHHHHHSSGVDLGTENLYFQSMEQVAMELRLTELTRLLRSVLDQLQDKDPARIFAQPVS
LKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAA
VRLRDQGGVVLRQARREVDSIGLEEASGMHLPERPA
>5PPAB:Bromodomain-containing protein 1
MHHHHHHSSGVDLGTENLYFQSMEQVAMELRLTELTRLLRSVLDQLQDKDPARIFAQPVS
LKEVPDYLDHIKHPMDFATMRKRLEAQGYKNLHEFEEDFDLIIDNCMKYNARDTVFYRAA
VRLRDQGGVVLRQARREVDSIGLEEASGMHLPERPA