Sequence (fasta): 1e4qDownload

>1E4QA:BETA-DEFENSIN 2
PVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP